PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v1698970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 474aa    MW: 52812.3 Da    PI: 6.8535
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v1698970.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.45.6e-53501771128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      l+pGfrFhPtdeelv +yLk+kv gk++++ ++i+evdiyk+ePwdL   +++k++++ewyfFs  dkky +g r nrat++gyWkatg+d++v
  Lj5g3v1698970.1  50 LAPGFRFHPTDEELVIYYLKRKVCGKNFRF-DAISEVDIYKSEPWDLAdkSRLKTRDQEWYFFSALDKKYGNGGRMNRATSQGYWKATGNDRPV 142
                      579**************************9.99**************75348899999************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + ++++vglkktLvf++grap+g++t+Wvmheyr+
  Lj5g3v1698970.1 143 RH-GQRTVGLKKTLVFHSGRAPDGKRTNWVMHEYRI 177
                      **.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-6141205IPR003441NAC domain
PROSITE profilePS5100558.14450204IPR003441NAC domain
PfamPF023653.9E-2752177IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MGRETQLILA PPTTTTTTTV EPQPPPPPPP LAAPSASASA AAVAAPPTSL APGFRFHPTD  60
EELVIYYLKR KVCGKNFRFD AISEVDIYKS EPWDLADKSR LKTRDQEWYF FSALDKKYGN  120
GGRMNRATSQ GYWKATGNDR PVRHGQRTVG LKKTLVFHSG RAPDGKRTNW VMHEYRIVEE  180
ELERVGTGSS QPQDAYVLCR VFHKNNIGPP NGQRYAPFIE EEWDDDASGL VPGVEPVGDG  240
SVARHARVEG NGVSCSEGRN DVVQDTQSIN KAPFDVTNLP IETQNLIAVC KRAKMDEFPS  300
PEKDDSKQMQ MDEYPSSQTD NPKPFSQIYK RRRYNLNSNH SHASGDSVQT NQGPCSSTIT  360
TAATTLPTTT TTEAATNPAP KKHFLSALVE YSLLESLESK ESPVSIKPED LDAAHPTCTK  420
FLKQMQSEMQ KLSVEKETMR FELMSTQTMI KILQSRNDVL TKENEELKRM MGNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-484920619170NAC domain-containing protein 19
3swp_C3e-484920619170NAC domain-containing protein 19
3swp_B3e-484920619170NAC domain-containing protein 19
3swp_A3e-484920619170NAC domain-containing protein 19
3swm_D3e-484920619170NAC domain-containing protein 19
3swm_C3e-484920619170NAC domain-containing protein 19
3swm_B3e-484920619170NAC domain-containing protein 19
3swm_A3e-484920619170NAC domain-containing protein 19
4dul_B4e-484920616167NAC domain-containing protein 19
4dul_A4e-484920616167NAC domain-containing protein 19
1ut7_B4e-484920616167NO APICAL MERISTEM PROTEIN
1ut7_A4e-484920616167NO APICAL MERISTEM PROTEIN
1ut4_B4e-484920616167NO APICAL MERISTEM PROTEIN
1ut4_A4e-484920616167NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.130350.0cell culture| protoplast| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0105230.0AP010523.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT23O16, TM1810, complete sequence.
GenBankAP0105240.0AP010524.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT34P16, TM1824, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014514246.10.0PREDICTED: NAC domain-containing protein 7-like
TrEMBLA0A0B2NZQ20.0A0A0B2NZQ2_GLYSO; NAC domain-containing protein 78
TrEMBLA0A0L9TE350.0A0A0L9TE35_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SP610.0A0A0S3SP61_PHAAN; Uncharacterized protein
STRINGGLYMA20G33430.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF81893241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.11e-102NAC domain containing protein 50